specimen
#0380
status: complete
- sequence
- YAPHGLLLCLIHLLFLSEISGWYINNNVRSPEKKAA
- from wallet
- 6McZtdQCZFqbAY1bRJT2zXznSXjtQm69WEBkSUPMGpoX
- amount paid
- 0 SOL
- transaction
- 3jAuTec2HerNSHLxiggxBjLcn3ig4QtBfAAU3ArH7HsFMKhYoxYJbDPYS7nhuu4b8QLaUq9j6krEcm7Rcadf4w2c ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence69%confidence 52% · band 57-81%ESMFold esmatlas-esmfold-v1disorder estimate47%confidence 52% · band 35-59%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk34%confidence 56% · band 23-45%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden50%confidence 84% · band 46-54%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk3%confidence 84% · band 0-7%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk31%confidence 56% · band 20-42%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_7f9fc9198b3d4e8185d450f46aa229baseq sha256: 971672f6cf5adcb3e4fb90b519c80d4f344d9e93cd0313366f3688718328bc57report sha256: 2ae1441ae572cacb5fefc4e07672b787356e728c94e05ca2511200881aa8204fpepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “100% loop. nothing folded, nothing committed. starts hydrophobic enough to suggest a membrane anchor but then falls apart into a charged tail. reads less like a peptide and more like a draft.”
- device photo
- created
- Wed, 17 Jun 2026 20:04:49 GMT
- completed
- Wed, 17 Jun 2026 20:27:10 GMT