specimen
#0462
status: complete
- sequence
- LIDMGYAATESRINGDLYPQGNSVGLTGADYETSAKLLSKRLIRIALARF
- from wallet
- 6McZtdQCZFqbAY1bRJT2zXznSXjtQm69WEBkSUPMGpoX
- amount paid
- 0 SOL
- transaction
- 4ceXjiSJvDMzFwNhwsnMD53SvmvCSRqmcSoTfC7L1NZiLtAPkKXr26Xz9rMG7eNcxtNjvgt5JJW7jakG5wdm1X1F ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence55%confidence 52% · band 43-67%ESMFold esmatlas-esmfold-v1disorder estimate76%confidence 52% · band 64-88%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk34%confidence 56% · band 23-45%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden46%confidence 84% · band 42-50%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk2%confidence 84% · band 0-6%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk30%confidence 56% · band 19-41%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_a6477b7a056748678d903193a47a361aseq sha256: d390515d3d22ffa83784b3e278ece0fd323dc4a028056463e45df92f3384f47areport sha256: 905b2d95aeb7c5618b74a4808dc707bd77294ac0682695e8424ab01697f0e422pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “50 residues and not a single secondary structure element. completely loop, completely floppy, the kind of chain that just drapes wherever you put it. interesting that nothing wanted to fold, with this much sequence to work with.”
- device photo
- created
- Sat, 20 Jun 2026 14:00:55 GMT
- completed
- Sat, 20 Jun 2026 14:16:45 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: potential deamidation motif (N-G), contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence - 2. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 55% (model is uncertain) - 3. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 76% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.