#0454
- sequence
- VQLVNTATSKTNGVDGRGAQADRDLLETPENGMGQAELSMLDAS
- from wallet
- 5Dy8AaYHrAHDwPHXcKMZNSv7C1SUc9EJpqwRnURdx6oQ
- amount paid
- 0 SOL
- transaction
- RfKgLJb3uTPBJk9dK3R11f4oA2DyjAB6rWzUQuw2EBwso29uLNUcjthKH528LTt6NjXQutha9dBQbockgxJWpFC ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence56%confidence 52% · band 44-68%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk30%confidence 56% · band 19-41%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden34%confidence 84% · band 30-38%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk9%confidence 84% · band 5-13%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- audit trail
- run: run_670e8923cbc74c2f9960bed739dfcc83seq sha256: a57ee38845f69118c8e9fef3189a997e0b9b07a1a3cca840cac7bf9e99214561report sha256: 6f857785ac525aa5063c64623e111dae78747415c2e806f056432d0913956f66pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “all loop. zero structure, just 44 residues of vibes. composition is messy, charges scattered, no hydrophobic core to organize around. this one never decided what it wanted to be.”
- device photo
- created
- Sat, 20 Jun 2026 13:56:32 GMT
- completed
- Sat, 20 Jun 2026 13:58:59 GMT
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: potential deamidation motif (N-G), potential isomerization motif (D-G), contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 3 motif liability flag(s) in the sequence - 2. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 56% (model is uncertain) - 3. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)