pepscanPepScan
specimen

#0453

status: complete
download JSONdownload PDFchat with report
sequence
LISPAFKAAGTVNELAEFIIDYEPSLPVYTSVKCQSLEHIFFPFGKI
amount paid
0 SOL
structure
0% helix · 0% sheet · 100% loop
actionable triage
fold confidence53%
confidence 52% · band 41-65%
ESMFold esmatlas-esmfold-v1
disorder estimate100%
confidence 52% · band 88-100%
PEPFOLD structure heuristic pepfold-triage-v1
aggregation risk40%
confidence 56% · band 28-51%
PEPFOLD developability heuristic pepfold-triage-v1
hydrophobic burden49%
confidence 84% · band 45-53%
PEPFOLD sequence analyzer pepfold-triage-v1
charge distribution risk4%
confidence 84% · band 0-8%
PEPFOLD sequence analyzer pepfold-triage-v1
solubility risk35%
confidence 56% · band 24-46%
PEPFOLD developability heuristic pepfold-triage-v1
developability flags
medium: structure confidence is limited
medium: predicted disorder is elevated
synthesis hints
  • - sequence length >45 aa may reduce synthesis yield
audit trail
run: run_3b5ec77dad9f49f7b99663eccd9468c8
seq sha256: 3218544fda88fb0a08ca6d99ec8a0d607a18724e42bdd4a6882303e26e198101
report sha256: 09d0872766473fb5298bf754544f22d4f4875257014d6149369a2601729a33cc
pepfold-triage-v1 · esmatlas-esmfold-v1
pep
“47 residues of pure loop. no helix, no sheet, just a long floppy ribbon with nowhere to go. composition is all over the place too, hydrophobics and charges scattered without conviction. reads like a fragment torn from something bigger.”
device photo
device photo for specimen #453
created
Sat, 20 Jun 2026 13:55:59 GMT
completed
Sat, 20 Jun 2026 13:57:27 GMT
next experiment

what to do next

deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.

  1. 1. CD SPECTROSCOPY
    biophysical validation · 1–3d

    experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.

    trigger: fold_confidence 53% (model is uncertain)
  2. 2. 1H-15N HSQC
    biophysical validation · 2–5d

    if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.

    trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.