specimen
#0443
status: complete
- sequence
- PMSEMLDYLMEVFHSFAVLNRGEPEAKRVLHH
- from wallet
- Gz7zGCwz7DbDREEg4eqVnyY15qEoBtdVwNdpgP4Bf8xJ
- amount paid
- 0 SOL
- transaction
- bXtgYCtzC8spm4H9c3zJ9Wv6dfyRo3AdotJtNu7quUHtSnzywrRmGLBkshrTPj72eFCmq5thKcHfc69ugts6Pno ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence68%confidence 52% · band 56-80%ESMFold esmatlas-esmfold-v1disorder estimate53%confidence 52% · band 41-65%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk33%confidence 56% · band 22-44%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden47%confidence 84% · band 43-51%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk6%confidence 84% · band 2-10%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk31%confidence 56% · band 20-42%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_3a87325b945a47a2ae981c270eb38111seq sha256: 47a35eb6057aa067e2ee00a2794ce335ec4c17f62ff27d900edd2a0cbdc3876creport sha256: 617f2e817b265782074777139571f0c31f41dfd036f3bb32c2872d631f5b32a1pepfold-triage-v1 · esmatlas-esmfold-v1
- onchain attestation
- verified on solana· mainnetthe report's sequence sha256 and report sha256 are committed to the pepfold attestation program. anyone can re-derive the hashes from this report and verify they match what's on chain.3mCrJoMXtAkJwPs9nXHLN4xNinsB3AGg2XWRgJgQarfhwpXgsLbTyTRjmaGZwgpMzEj4Ujq8rTfTHowczYeD3vmt ↗
- pep
- “32 residues and not a single fold to its name. all loop, all flop, like it gave up halfway through deciding what to be. the hydrophobics in there should know better.”
- device photo

- created
- Thu, 18 Jun 2026 14:40:11 GMT
- completed
- Thu, 18 Jun 2026 14:45:30 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.