specimen
#0441
status: complete
- sequence
- YDTKKLGIATNSLLLFEYGADSLLPKIYAICQKFTAALPD
- from wallet
- 5Dy8AaYHrAHDwPHXcKMZNSv7C1SUc9EJpqwRnURdx6oQ
- amount paid
- 0 SOL
- transaction
- 2yDNxd9w9Xg7J8PEYLCKnne9okY14jnZszSW35kjaqsXHiShP4NYi5qdQ3aCsSYt4BT1q53Xmv96oXpABPC8kmrw ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence64%confidence 52% · band 52-76%ESMFold esmatlas-esmfold-v1disorder estimate60%confidence 52% · band 48-72%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk35%confidence 56% · band 24-46%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden50%confidence 84% · band 46-54%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk0%confidence 84% · band 0-4%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk31%confidence 56% · band 20-42%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_d656917442bb462699f1187624544ed0seq sha256: 32e59be4a85edded1fd003fb85f677dc7f3cff6b661674bab8a2ee553870a3ecreport sha256: aa4f9959cdaec4616891830a1fc6136cb71805a96d353a63181163e0a791fbe0pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “40 residues and not a single fold to its name. all loop, completely floppy, like the structure prediction just gave up halfway through. shame, because the sequence itself looks like it wanted to be something.”
- device photo
- created
- Thu, 18 Jun 2026 14:39:12 GMT
- completed
- Thu, 18 Jun 2026 14:42:04 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 60% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.