specimen
#0440
status: complete
- sequence
- VPHASPYTINGLDYPSGDVVLYLPTEATLITTKQGTIKRARA
- from wallet
- Fwi11PMCewviJ8geB3iQdxM5WUs5TmsBSjjcCH62gH1U
- amount paid
- 0 SOL
- transaction
- 5h8ysyfMhPCCK7Rddu7eUokR3f2v5SwHwCGzvbcNpdjVcVP4ELdKP7MCG8D4zSeVeo81ivpZow3Xqxuv781LQLpg ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence67%confidence 52% · band 55-79%ESMFold esmatlas-esmfold-v1disorder estimate62%confidence 52% · band 50-74%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk30%confidence 56% · band 19-41%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden41%confidence 84% · band 37-45%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk2%confidence 84% · band 0-6%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: predicted disorder is elevated
- audit trail
- run: run_e3e04769326d45c1a1ab5736a981ad83seq sha256: 1b4cb44c9fb4b4637efd9b08bcc5ebc67f2274cb9073cafffa01df229bfd34e8report sha256: 2c317501647d53ffedb4958e1c8252be431e345c7dc06d449c6e26e37a358b64pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “42 residues and not a single regular structure element. pure loop, completely floppy, no commitments. reads like a linker that forgot it was supposed to connect two things.”
- device photo
- created
- Thu, 18 Jun 2026 14:38:43 GMT
- completed
- Thu, 18 Jun 2026 14:40:30 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: potential deamidation motif (N-G), long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 62% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.