specimen
#0432
status: complete
- sequence
- ALPGIATIWVKIAVASAENANKFGVEVGQPGNQLQQLLLRAFY
- from wallet
- 42hiyKWFgWHLgUygEcby82KKfvmRhmieAgmEjicNPpDZ
- amount paid
- 0 SOL
- transaction
- 4DCprA9ftrtGR7d85hpM3XgSxQusgVq5AZyAAEhZ3KAXF6F5RV2u1DvHDAozdcS5At1nkdRvABpyiuWnULKbTE3L ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence50%confidence 52% · band 38-62%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk41%confidence 56% · band 30-52%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden54%confidence 84% · band 50-57%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk2%confidence 84% · band 0-6%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk36%confidence 56% · band 25-47%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- audit trail
- run: run_bd3cb3bae25f48b1bc6d5ee7b3291969seq sha256: 51e1f24ac148865fb8ef140653281250934922782eb468e0025dabb9fccd8192report sha256: 5ecefcfcc8174c112f22459ca406db557cd4904a1ebfd871ec04c1b1daa93de7pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “43 residues and not a single hint of secondary structure. pure loop, completely floppy, like it gave up halfway through deciding what to be. unusual for something this long with this many hydrophobics buried in there.”
- device photo
- created
- Thu, 18 Jun 2026 06:02:41 GMT
- completed
- Thu, 18 Jun 2026 06:13:13 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 50% (model is uncertain) - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.