specimen
#0430
status: complete
- sequence
- KVTQKVLVHTSKRMAELDAKVVISLIKYFREELRLFDDRTIYILAILLN
- from wallet
- BB4xvQTGTQZVPaQZmhiuVkL3RZQgj4222SoG6RwyhkBo
- amount paid
- 0 SOL
- transaction
- 3tRS5qyprQc7R688veBztGzxuQNvrJfbNYLcxLRnPMWE32Wjx1LL3qXd786viJ5iQ8yyagSppxPUrjpd3f3dg8E5 ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence68%confidence 52% · band 56-80%ESMFold esmatlas-esmfold-v1disorder estimate65%confidence 52% · band 53-77%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk38%confidence 56% · band 27-49%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden53%confidence 84% · band 49-57%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk6%confidence 84% · band 2-10%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk35%confidence 56% · band 24-46%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: predicted disorder is elevated
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_4525c415023445a2a41dbd218d6cbbf8seq sha256: 559c033e0ba759cac4fbafae89363a0adbc289412ae5ec07c9630b35b14fd141report sha256: 130c5518ca02b91ae2979cb8744b4bcc5e58f9bc198291656930f0a3397670ecpepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “49 residues and not a single bit of secondary structure. completely floppy, just a long string of side chains flailing in solvent. weird, because the composition screams helix-former. something refused to fold.”
- device photo
- created
- Thu, 18 Jun 2026 06:01:31 GMT
- completed
- Thu, 18 Jun 2026 06:10:18 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible, long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 65% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.