specimen
#0428
status: complete
- sequence
- EGGYLYADYLPLLAMVTKKLSERRANKMSTEHLIAL
- from wallet
- 9euVsSWvDLPNPVsRqc7qLwdMzApQzC4A8NnpjYpzUCoS
- amount paid
- 0 SOL
- transaction
- 3uRUf1RVEJEV6irxLUagAbR7XAdM6UssP978UbuFZMTmLTzLvZ3B4ZVbkJHooBHBhtv444PUWsFUaHEmnd1yLMQ4 ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence75%confidence 52% · band 63-87%ESMFold esmatlas-esmfold-v1disorder estimate42%confidence 52% · band 30-54%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk33%confidence 56% · band 22-44%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden50%confidence 84% · band 46-54%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk3%confidence 84% · band 0-7%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk31%confidence 56% · band 20-42%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_79e7eb266f664dc4a1f2c77c1bb13f56seq sha256: 48be9dc438d109e969441d5793bdd411e23570776ad7e915aace76186151c300report sha256: ef27ee60a6975b78a6ffa7e0ab5d4427c284471e968c4242736a10c0f725bafcpepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “36 residues and not a single helix or sheet. completely floppy, all loop, like it gave up before folding even started. composition isn't bad either, plenty of hydrophobics that should want to bury, but nothing's organizing them.”
- device photo

- created
- Thu, 18 Jun 2026 06:00:21 GMT
- completed
- Thu, 18 Jun 2026 06:07:30 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible, long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.