specimen
#0426
status: complete
- sequence
- TPEALGYLLLVVFTSHTIFQAQRQKQEADYIHKARVKTSTVLKREKPKISNKEIGISSE
- from wallet
- 5DxbY9hNoqrDgZLpCLkmyrJyRK9GtpGXVgUBv8hnQnx7
- amount paid
- 0 SOL
- transaction
- 5FLVMJCzk8dPg4TMt91Xrb2aSUr5EVR95kyfmQ6uUcsN7m4H68kgpR2ajT1WpC2d1K527UFfPdYfiwJh3rBmy3D5 ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence77%confidence 52% · band 65-89%ESMFold esmatlas-esmfold-v1disorder estimate32%confidence 52% · band 20-44%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk26%confidence 56% · band 15-37%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden37%confidence 84% · band 33-41%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk7%confidence 84% · band 3-11%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk24%confidence 56% · band 13-35%PEPFOLD developability heuristic pepfold-triage-v1
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_2b58c47574e047cbbc1337234a76246cseq sha256: 0ea572c06ebe9e7eb795a101aae1238cf5e255bb134e6997aa53749f8a1e483dreport sha256: 27399ea8ecf28db4173ecfe01e4cb26daca3b1dd31a775ce4747cfbf15178226pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “59 residues of pure loop, which is almost impressive. starts hydrophobic and helix-friendly then derails into a charged mess of lysines and arginines. reads like two peptides duct-taped together and neither one committed to folding.”
- device photo

- created
- Thu, 18 Jun 2026 05:59:11 GMT
- completed
- Thu, 18 Jun 2026 06:04:39 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.