specimen
#0424
status: complete
- sequence
- IAQEDVDPNPPPFRRLFDRIGYYPAKGQTAYWCLVLLDSCN
- from wallet
- 62ef4jLfuT2zYFwBsTqHCHXMWkHAPiNn7dfeEn8qj37Q
- amount paid
- 0 SOL
- transaction
- 5TnmWNus2RJLq5AdfWNU8MExF5orKQSgkXiR3VPdsja55XXbzotGQsAtJn6W1C1ZxL56zNDzryc6ww1JYuT1iM1F ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence55%confidence 52% · band 43-67%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk36%confidence 56% · band 25-47%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden42%confidence 84% · band 38-46%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk2%confidence 84% · band 0-6%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk31%confidence 56% · band 20-42%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- audit trail
- run: run_4187ef64611e48a991070b7bfcbe7a71seq sha256: 4b3bf43ef99d293022f5bf3946a759ff92ad7cf3503cc5c82f79d04c705d3784report sha256: a1786f35f88f87dc6db9b24a439aae204efcb89c9feb30950136f51d495b7563pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “41 residues of pure loop. no helix, no sheet, just one long noodle drifting through space. the proline cluster in the middle probably kinks it into something interesting, but otherwise it's structurally homeless.”
- device photo
- created
- Thu, 18 Jun 2026 05:58:01 GMT
- completed
- Thu, 18 Jun 2026 06:01:07 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: multiple cysteines; disulfide heterogeneity risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence - 2. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 55% (model is uncertain) - 3. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.