specimen
#0415
status: complete
- sequence
- AGSSGMDRMCYHAEESNGIVPYLLMSTIVIFYLL
- from wallet
- 9mzrG2PMmmt1BUMNaVMKAPnANhhvX8LHrJH8w9LxKCR4
- amount paid
- 0 SOL
- transaction
- 3LyZ1o49XcYEaNP4Xud9tbQyttym7D47uRL1bQugWdBVG6zjGE8yuovwyFTzMpeXEPBD6Sp7wZMe231Z6onDCKuX ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence67%confidence 52% · band 55-79%ESMFold esmatlas-esmfold-v1disorder estimate59%confidence 52% · band 47-71%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk39%confidence 56% · band 28-50%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden53%confidence 84% · band 49-57%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk6%confidence 84% · band 2-10%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk35%confidence 56% · band 24-46%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_1afc30aeed44446ca9cbf8968fac7e96seq sha256: 98a760b14225f9f8a0e17c7effcbd278a9fa28e5951b74d5263ed6e6199eff0freport sha256: 165ddb678c8f05b09427c945d81ef937251c7e8202f45bd0229f4200017ed1f3pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “100% loop. no helix, no sheet, just 34 residues of pure indecision. ends in a hydrophobic streak that wants to fold but never commits. structurally homeless.”
- device photo

- created
- Thu, 18 Jun 2026 04:24:40 GMT
- completed
- Thu, 18 Jun 2026 04:39:23 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: potential deamidation motif (N-G), contains methionine; oxidation sensitivity possible, long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 3 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.