specimen
#0412
status: complete
- sequence
- VTKASILFLKMVEPTWWICSLIEPNAVITM
- from wallet
- 42hiyKWFgWHLgUygEcby82KKfvmRhmieAgmEjicNPpDZ
- amount paid
- 0 SOL
- transaction
- 2voZp6C9JZv2wZtYn4HgejzQHokXfXBmU469KQDDoPGfuWBkr6cgS6tumttj6rZw8sDqNnp4D3z9CQusBUGVpLPo ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence65%confidence 52% · band 53-77%ESMFold esmatlas-esmfold-v1disorder estimate93%confidence 52% · band 81-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk42%confidence 56% · band 31-53%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden57%confidence 84% · band 53-61%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk0%confidence 84% · band 0-4%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk37%confidence 56% · band 26-48%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: predicted disorder is elevated
- audit trail
- run: run_9c0ba321e81f45ce8feeee18889c65f0seq sha256: b9a6292e5ea8436f21d1dd370728680b432f26d89951042f2369abaed7a0382freport sha256: fc2f74be27ad59bb6f572bb1fcb11c401672b743bbbd47fd7e0995a139625aa1pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “30 residues and not a single fold to show for it. all loop, all floppy, despite a hydrophobic core that really should know better. two tryptophans wasted on something this structureless.”
- device photo
- created
- Thu, 18 Jun 2026 04:22:55 GMT
- completed
- Thu, 18 Jun 2026 04:34:58 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 93% (high) - 3. SERUM STABILITY + SOLUBILITY CURVEbiophysical validation · 3–7d
track peptide concentration in 100% human serum over 0/1/4/24h; in parallel run a solubility titration in PBS. tells you whether the peptide survives long enough to act.
trigger: hydrophobic_burden 57% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.