specimen
#0400
status: complete
- sequence
- EFMLCELAEGLHTFAKLMSNLEVKLRAVTYRAAALKYTESTAADALKVSE
- from wallet
- CRJFU5HfNsiGofAQ152DJLLqg1FW5mhJj9arTrpE9zyi
- amount paid
- 0 SOL
- transaction
- 2vFSzYZKJRhW9BdQFXFCm9cepXfvCu8gt3kEHYUY2H2dcMgwRKdrmDErXGdotWe2QnLhtUZ5D4KWwaybPREQ8JTJ ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence90%confidence 52% · band 78-100%ESMFold esmatlas-esmfold-v1disorder estimate0%confidence 52% · band 0-12%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden52%confidence 84% · band 48-56%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk2%confidence 84% · band 0-6%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk28%confidence 56% · band 17-39%PEPFOLD developability heuristic pepfold-triage-v1
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_e4f0a484b3d244df8e85b50e138a7f4dseq sha256: 21f2dbd56aacbfea55214197b1693fe10f2772349d360e5e6205815db7776d0breport sha256: ea2edc7bb7e8e38422e41c075c9aa1dd9973887ebf8f31ad8131a40118664371pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “50 residues and not a single helix or sheet turn. completely floppy, just a long ribbon of nothing committing to anything. shame, because the composition has plenty of leucines and alanines that should know better.”
- device photo
- created
- Wed, 17 Jun 2026 21:09:53 GMT
- completed
- Wed, 17 Jun 2026 21:28:01 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.