specimen
#0395
status: complete
- sequence
- IPTAFGIDDESSSSFWFIPLLCGLKLKGLRVKRSRADDNYSGYGRNPIADWANDYEPF
- from wallet
- 9mzrG2PMmmt1BUMNaVMKAPnANhhvX8LHrJH8w9LxKCR4
- amount paid
- 0 SOL
- transaction
- enLJJmWaWZaTCi97sxdupamJsmfjeJwqxWScNKXkEG6Gg6saE5bndwWh8SqZXvpCzzqBRfN7EK6VgJnqrGMGamw ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence47%confidence 52% · band 35-59%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk35%confidence 56% · band 24-46%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden40%confidence 84% · band 36-44%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk2%confidence 84% · band 0-6%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk29%confidence 56% · band 18-40%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_05fa320132754137a214246e9b7597daseq sha256: 729f5abb39bedea2ada402053bb4b38e555973ebce9fa9d29b2f8942d53f7556report sha256: 506bba0406951f8cc03640ab334509459228be9b4685ec4cf7d55a27864b5635pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “all loop, no structure, 58 residues of pure indecision. some interesting fragments in there, the KLKGLRVKRSR stretch is basic and charged like it wants to bind something, but nothing folds. reads like a peptide that forgot its job.”
- device photo
- created
- Wed, 17 Jun 2026 21:07:03 GMT
- completed
- Wed, 17 Jun 2026 21:20:21 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 47% (model is uncertain) - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.