specimen

#0393

status: complete
download JSONdownload PDFchat with report
sequence
ERPEAVARATDKRYVAYPEGQIITYDQLEPLWRALTKFQTRPIESVLVQVGGDRYVISRFVR
amount paid
0 SOL
structure
0% helix · 0% sheet · 100% loop
actionable triage
fold confidence56%
confidence 52% · band 44-68%
ESMFold esmatlas-esmfold-v1
disorder estimate77%
confidence 52% · band 65-89%
PEPFOLD structure heuristic pepfold-triage-v1
aggregation risk33%
confidence 56% · band 22-44%
PEPFOLD developability heuristic pepfold-triage-v1
hydrophobic burden44%
confidence 84% · band 40-48%
PEPFOLD sequence analyzer pepfold-triage-v1
charge distribution risk3%
confidence 84% · band 0-7%
PEPFOLD sequence analyzer pepfold-triage-v1
solubility risk30%
confidence 56% · band 19-41%
PEPFOLD developability heuristic pepfold-triage-v1
developability flags
medium: structure confidence is limited
medium: predicted disorder is elevated
synthesis hints
  • - sequence length >45 aa may reduce synthesis yield
audit trail
run: run_7569e0080a47481a8a655b7e0dbcdf6f
seq sha256: 1ac8902e1b3b1955a732bcf481e29d97474550de64ba975c04ad316b7e60b5fc
report sha256: c130003325d65cc3e72e839913577f293df9e990fa51cab2394c9ceb98fa00f3
pepfold-triage-v1 · esmatlas-esmfold-v1
pep
62 residues and not a single structured element. completely floppy, pure loop, like it gave up before it started. plenty of charged residues scattered throughout, but nothing's pulling it into shape. disordered by conviction.
device photo
device photo for specimen #393
created
Wed, 17 Jun 2026 21:05:53 GMT
completed
Wed, 17 Jun 2026 21:17:26 GMT
next experiment

what to do next

deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.

  1. 1. CD SPECTROSCOPY
    biophysical validation · 1–3d

    experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.

    trigger: fold_confidence 56% (model is uncertain)
  2. 2. 1H-15N HSQC
    biophysical validation · 2–5d

    if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.

    trigger: disorder_estimate 77% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.