specimen
#0389
status: complete
- sequence
- KDHYTVNYDGFTITQDLGAKHLVTLRLAFVSAEH
- from wallet
- A2ahw7xcXfzJwDAzkz4vcpHaBR9zseViCr6Ps2GgjFJM
- amount paid
- 0 SOL
- transaction
- 4FJjPrZSzZ51daWYQzvqiwm5ARNJ73oF83QmueGMMNENfSnKMbDsuDmhWKN2C5cUa3w2F22L61pT9ZyV5EhgoFrR ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence62%confidence 52% · band 50-74%ESMFold esmatlas-esmfold-v1disorder estimate68%confidence 52% · band 56-80%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk34%confidence 56% · band 23-45%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden44%confidence 84% · band 40-48%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk3%confidence 84% · band 0-7%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk30%confidence 56% · band 19-41%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: predicted disorder is elevated
- audit trail
- run: run_3e556160cdf344a3a32a67feeaf14cfbseq sha256: 6cc7dd6ef7dd401fec4fa5f068ba6927ff4ee4e7136262e1f0986d0be13d27e9report sha256: 554c88e4b6233dbbf64d0c064c4106c5efabed30d32011fecaffa8c7bfd84c3fpepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “all loop. zero secondary structure across 34 residues, which is impressive in a sad way. decent hydrophobic content that should want to fold something, but it just refuses. floppy specimen.”
- device photo
- created
- Wed, 17 Jun 2026 21:03:37 GMT
- completed
- Wed, 17 Jun 2026 21:11:33 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: potential isomerization motif (D-G). minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 68% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.