specimen
#0387
status: complete
- sequence
- GALYLSRVPLKRDRPIVGSARTPTSGYEGYEFTLRRALC
- from wallet
- 4UgHEB2Gm6Y4AEhdMUup3Q1DDCQvEYUVoLtdyivXBRLw
- amount paid
- 0 SOL
- transaction
- 3wZuMofNeqbf6jeQqPT2K9hq7KbVpeB1HvmLrTEDniA5XgsUp57znTrA4sLFT59fbeZY8TeS8kTDxxaSXU5qVcLq ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence53%confidence 52% · band 41-65%ESMFold esmatlas-esmfold-v1disorder estimate97%confidence 52% · band 85-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk35%confidence 56% · band 24-46%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden39%confidence 84% · band 35-43%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk10%confidence 84% · band 6-14%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk31%confidence 56% · band 20-42%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- audit trail
- run: run_7c1bc51a1f43478098457a94c766fd87seq sha256: ad1d14327134d0d586b0c080693de795634cdccb97af369a8ca01b6672326cb8report sha256: 18fcb4d268b12b26b2b1a42f5db2a883a05068500342cb0581a6f7349954c8c2pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “all loop, no structure, just 39 residues of pure indecision. lots of arginines and prolines scattered through, which probably explains why nothing folds. reads like an intrinsically disordered region someone clipped out and forgot to attach to a protein.”
- device photo
- created
- Wed, 17 Jun 2026 21:02:29 GMT
- completed
- Wed, 17 Jun 2026 21:08:26 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 53% (model is uncertain) - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 97% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.