specimen
#0385
status: complete
- sequence
- PRVDVDLNEIIDKWDIANCLVQLSEGGLRKINRQQELDVFLTSSESVQYVWY
- from wallet
- Gz7zGCwz7DbDREEg4eqVnyY15qEoBtdVwNdpgP4Bf8xJ
- amount paid
- 0 SOL
- transaction
- bCodVr4jcregBdeB84HDpFamyRRyXHtQsbaWbTvMz8NqXQXhzVSMCwHHdid4sdQgjLfiHAHqXC84CrLBC8Qs1WV ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence47%confidence 52% · band 35-59%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk36%confidence 56% · band 25-47%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden42%confidence 84% · band 38-46%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk8%confidence 84% · band 4-12%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk32%confidence 56% · band 21-43%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_50c51445bf6f4638ab52f8cf80f7866cseq sha256: 0a83d929ec7f391a102800bd4b3fafbde0bcc090e7b30e76171b07d1d1777339report sha256: a2dcee535d049a2b5191002df9c6c57958165f20469a005482081a91c3201abcpepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “52 residues of pure loop. nothing folded, nothing trying to. just a long floppy ribbon drifting through space, hydrophobics and charges all mixed up with no plan. unstructured but not boring.”
- device photo
- created
- Wed, 17 Jun 2026 21:01:21 GMT
- completed
- Wed, 17 Jun 2026 21:05:35 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 47% (model is uncertain) - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.