specimen
#0382
status: complete
- sequence
- VFKLTQVRSLELEHETELKNILPNFSINQVTLIEYSTLHCCLHVLSSQEVF
- from wallet
- Fwi11PMCewviJ8geB3iQdxM5WUs5TmsBSjjcCH62gH1U
- amount paid
- 0 SOL
- transaction
- 4dJXsnXfvSP6Tx1zqsdbNgNTHtmeFudz9YaUUrw6rACRDA2MC9bkqHmpBobBt6un48rLWDQ1kyhtKRVnwroB6A71 ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence41%confidence 52% · band 29-53%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk34%confidence 56% · band 23-45%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden41%confidence 84% · band 37-45%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk6%confidence 84% · band 2-10%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk30%confidence 56% · band 19-41%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_ccb8a44a7db44ca29198d38ede41b542seq sha256: 0b54eb51b89b692d1148759adf6ed13876247137d0eb95f829b3cc8fab78fb80report sha256: 50faf9aaf0ebe65c80183d4186e7eea3dbef68b61823ca94d0e2f46e0dd60579pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “51 residues and not a single ordered fragment. pure loop, completely floppy, like a sentence with no punctuation. something about the composition refused to commit to any structure at all.”
- device photo
- created
- Wed, 17 Jun 2026 20:59:36 GMT
- completed
- Wed, 17 Jun 2026 21:01:03 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: multiple cysteines; disulfide heterogeneity risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence - 2. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 41% (model is uncertain) - 3. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.