specimen
#0379
status: complete
- sequence
- MSTNPKPQRITFDEALKAAGYEVVLDKNTQLGLNQF
- from wallet
- 2A2WXH7JzGaf535apM2U8cPFbUfyCUe8prNrDrgsfKcf
- amount paid
- 0 SOL
- transaction
- 63BTXqpaVmtBXkusQWAVBakG1X3KAwyCFrZ4okZy22ZyM7TooU5yV56Ctxxce7umNsTGMBd99kKtZcAJqdSfcGsg ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence69%confidence 52% · band 57-81%ESMFold esmatlas-esmfold-v1disorder estimate42%confidence 52% · band 30-54%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk26%confidence 56% · band 15-37%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden39%confidence 84% · band 35-43%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk0%confidence 84% · band 0-4%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk24%confidence 56% · band 13-35%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_2cf4ad89798e48e39cd3ebdce1e03380seq sha256: 4c364cf1ceb8dc6929b36294c6ff7b3e8348f3cfba0a595a34c92537b3592909report sha256: e86f0af0e0d5e1ed0af739b6cb25fe360f1af282959e2453dee00dfce07a3923pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “completely unstructured. 36 residues of pure loop, no helix, no sheet, just vibes. has the look of a disordered region clipped out of context, the kind that only folds when it meets a partner.”
- device photo

- created
- Wed, 17 Jun 2026 20:04:15 GMT
- completed
- Wed, 17 Jun 2026 20:25:45 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.