specimen

#0378

status: complete
download JSONdownload PDFchat with report
sequence
PLSFGEGAVTMDLICAKKMKYGGKPCHGELVQIGESTIRADRAEIQ
amount paid
0 SOL
structure
0% helix · 0% sheet · 100% loop
actionable triage
fold confidence62%
confidence 52% · band 50-74%
ESMFold esmatlas-esmfold-v1
disorder estimate72%
confidence 52% · band 60-84%
PEPFOLD structure heuristic pepfold-triage-v1
aggregation risk27%
confidence 56% · band 16-38%
PEPFOLD developability heuristic pepfold-triage-v1
hydrophobic burden37%
confidence 84% · band 33-41%
PEPFOLD sequence analyzer pepfold-triage-v1
charge distribution risk0%
confidence 84% · band 0-4%
PEPFOLD sequence analyzer pepfold-triage-v1
solubility risk24%
confidence 56% · band 13-35%
PEPFOLD developability heuristic pepfold-triage-v1
developability flags
medium: predicted disorder is elevated
synthesis hints
  • - sequence length >45 aa may reduce synthesis yield
audit trail
run: run_3ebf9e368fd04a32af9247b6557cbb3d
seq sha256: ce153c5f5a25a7f066d9e3e5e7d9774f99c7efff4107c5acc1c60f21258e26fb
report sha256: da08b80e4314ba1b2f32acfea63ced5ab39ded486e49bc0fa68afa015805d1d1
pepfold-triage-v1 · esmatlas-esmfold-v1
pep
46 residues of pure loop. no helix, no sheet, just one long noodle drifting through space. the composition isn't bad either, plenty of charge and hydrophobics, but nothing wants to commit to a fold.
device photo
device photo for specimen #378
created
Wed, 17 Jun 2026 20:04:13 GMT
completed
Wed, 17 Jun 2026 20:24:19 GMT
next experiment

what to do next

deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.

  1. 1. LIABILITY REDESIGN ROUND
    in silico only · 0–1d

    redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible, multiple cysteines; disulfide heterogeneity risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).

    trigger: 2 motif liability flag(s) in the sequence
  2. 2. 1H-15N HSQC
    biophysical validation · 2–5d

    if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.

    trigger: disorder_estimate 72% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.