specimen
#0378
status: complete
- sequence
- PLSFGEGAVTMDLICAKKMKYGGKPCHGELVQIGESTIRADRAEIQ
- from wallet
- BB4xvQTGTQZVPaQZmhiuVkL3RZQgj4222SoG6RwyhkBo
- amount paid
- 0 SOL
- transaction
- 3DHk9QFmyyvBqTddMe2XVHfqaonsjXYgDXuzcSW9pUiURJSQpazDXjJiJVukChgSdnfqE1FZggXz2q1wFWpWMpXN ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence62%confidence 52% · band 50-74%ESMFold esmatlas-esmfold-v1disorder estimate72%confidence 52% · band 60-84%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden37%confidence 84% · band 33-41%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk0%confidence 84% · band 0-4%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk24%confidence 56% · band 13-35%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: predicted disorder is elevated
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_3ebf9e368fd04a32af9247b6557cbb3dseq sha256: ce153c5f5a25a7f066d9e3e5e7d9774f99c7efff4107c5acc1c60f21258e26fbreport sha256: da08b80e4314ba1b2f32acfea63ced5ab39ded486e49bc0fa68afa015805d1d1pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “46 residues of pure loop. no helix, no sheet, just one long noodle drifting through space. the composition isn't bad either, plenty of charge and hydrophobics, but nothing wants to commit to a fold.”
- device photo

- created
- Wed, 17 Jun 2026 20:04:13 GMT
- completed
- Wed, 17 Jun 2026 20:24:19 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible, multiple cysteines; disulfide heterogeneity risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 72% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.