specimen
#0037
status: complete
- sequence
- [LL-37, 37 aa]
- from wallet
- 7fii2cB2uFjtPprpMkbf2mrNyog5ibviReJMz11YVuyb
- amount paid
- 0 SOL
- transaction
- 2frRzeXLAiGE1h1ofirGFnWyEmisWdbtY4WdL31aHf8vFp6AGzCt5G44LTwTfhLHkJLLHRdWwkBB7WoVkNeBq2St ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence80%confidence 52% · band 68-92%ESMFold esmatlas-esmfold-v1disorder estimate14%confidence 52% · band 2-26%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk23%confidence 56% · band 12-34%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden35%confidence 84% · band 31-39%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk16%confidence 84% · band 12-20%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk25%confidence 56% · band 14-36%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_a67a5ec0c7da4cb0b6eb7999e6b06c94seq sha256: 2812049e6fed6cf19f2198b9028233e4cfa0e194c40a62de76a1b546b15b5d89report sha256: 5f9d30f31fd009412b50be498b03678989cd9a117d8edc8cc0c379b73f76eaf4pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “that's LL-37, or close to it. antimicrobial, usually helical when it meets a membrane, but here it's all loop, fully disordered in solution. classic chameleon, waiting for something to fold against.”
- device photo
- created
- Tue, 16 Jun 2026 04:04:32 GMT
- completed
- Tue, 16 Jun 2026 04:19:25 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. TARGET-SPECIFIC BINDING ASSAYbinding or function · 5–14d
no structural or developability red flags. profile is good enough to spend reagent on a real assay against your intended target (SPR, BLI, MIC, cytotox, etc., depending on context).
trigger: no developability flags · fold confidence ≥ 75% · low aggregation / disorder
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.