specimen
#0367
status: complete
- sequence
- IFKKDGLPLDYVMRERKKFIMEKADRSEVWDRYVAELSV
- from wallet
- Gz7zGCwz7DbDREEg4eqVnyY15qEoBtdVwNdpgP4Bf8xJ
- amount paid
- 0 SOL
- transaction
- 2zjuXZjMmsSz11DFub5uFpUYqsfNaFKMQCLMVEt2CDgk1sx4Yua7hgdEB7BT1xWyUfwcxv8N95z5dSird6YE9J9i ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence68%confidence 52% · band 56-80%ESMFold esmatlas-esmfold-v1disorder estimate49%confidence 52% · band 37-61%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk32%confidence 56% · band 21-43%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden46%confidence 84% · band 42-50%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk3%confidence 84% · band 0-7%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk29%confidence 56% · band 18-40%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_8d80555cb73246eb9fb49886701c8149seq sha256: 6b860317edd0fca6a49fed5a9fe7b1f37eb9a8479c295f089716c85bdf2ad287report sha256: 782be5a7017cbea898b9c70c813ca5e9be96515dbbffb1ecdaaaf2d909ec7b65pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “39 residues of pure loop. nothing wants to commit. charged residues scattered everywhere, lots of lysines and glutamates pulling in different directions. reads like a disordered linker that forgot it was supposed to connect two things.”
- device photo
- created
- Wed, 17 Jun 2026 20:01:20 GMT
- completed
- Wed, 17 Jun 2026 20:06:44 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: potential isomerization motif (D-G), contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.