#0365
- sequence
- VRYILNLKKMDHWGTTLNIGGKYLRVLFAVQAPYHNGKATFLLL
- from wallet
- 62ef4jLfuT2zYFwBsTqHCHXMWkHAPiNn7dfeEn8qj37Q
- amount paid
- 0 SOL
- transaction
- 57BDmcEeSCunGddibKBDB1eQn5MSijAEi9TuqA12pLzXpkg29UWeEtxMn6WYZibqQKsJBZKgNETuP2Y7uf7mdeUV ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence53%confidence 52% · band 41-65%ESMFold esmatlas-esmfold-v1disorder estimate98%confidence 52% · band 86-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk42%confidence 56% · band 31-53%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden52%confidence 84% · band 48-56%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk11%confidence 84% · band 7-15%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk38%confidence 56% · band 27-49%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- audit trail
- run: run_325051320c254b6fa37b29f9aafc68fcseq sha256: cf4db5695eafd3c0a2c89dd255f63b7863a0e26aa97296d5bd0749547c0f582dreport sha256: 244c78b78a693fd558109bec487b33eb85acc3106443c9cd9bea332fdae4581epepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “44 residues and not a single hint of structure. pure loop, completely floppy, like a sentence with no punctuation. composition isn't even that bad, lots of hydrophobics that should want to fold something, but here we are.”
- device photo
- created
- Wed, 17 Jun 2026 20:00:45 GMT
- completed
- Wed, 17 Jun 2026 20:03:54 GMT
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: potential deamidation motif (N-G), contains methionine; oxidation sensitivity possible, long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 3 motif liability flag(s) in the sequence - 2. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 53% (model is uncertain) - 3. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 98% (high)