specimen

#0364

status: complete
download JSONdownload PDFchat with report
sequence
RDLEVSGAGASGRVVKKLLAISFTPRYNRDLKNLFRGRF
amount paid
0 SOL
structure
0% helix · 0% sheet · 100% loop
actionable triage
fold confidence54%
confidence 52% · band 42-66%
ESMFold esmatlas-esmfold-v1
disorder estimate100%
confidence 52% · band 88-100%
PEPFOLD structure heuristic pepfold-triage-v1
aggregation risk37%
confidence 56% · band 26-48%
PEPFOLD developability heuristic pepfold-triage-v1
hydrophobic burden41%
confidence 84% · band 37-45%
PEPFOLD sequence analyzer pepfold-triage-v1
charge distribution risk15%
confidence 84% · band 11-19%
PEPFOLD sequence analyzer pepfold-triage-v1
solubility risk34%
confidence 56% · band 23-45%
PEPFOLD developability heuristic pepfold-triage-v1
developability flags
medium: structure confidence is limited
medium: predicted disorder is elevated
audit trail
run: run_666ee13ead174c08bb5e0e2a16df72a8
seq sha256: 671ccd7777674abe348f3ca7985de04d6a00ec6aa3af8eb9c43e9cecc32c020f
report sha256: d6797b7ef712e4859aca62f7dd029ff5344a663415f1fddf6d8a25dbf42ce6c0
pepfold-triage-v1 · esmatlas-esmfold-v1
pep
39 residues and not a single secondary structure element. pure loop, completely floppy, the kind of chain that just drifts in solution. lots of arginines scattered throughout though, so it's at least electrostatically interesting.
device photo
device photo for specimen #364
created
Wed, 17 Jun 2026 20:00:12 GMT
completed
Wed, 17 Jun 2026 20:02:29 GMT
next experiment

what to do next

deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.

  1. 1. CD SPECTROSCOPY
    biophysical validation · 1–3d

    experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.

    trigger: fold_confidence 54% (model is uncertain)
  2. 2. 1H-15N HSQC
    biophysical validation · 2–5d

    if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.

    trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.