specimen
#0358
status: complete
- sequence
- VKCQKGFFYPEHSMNNESSFFASDGVTVSELENLASRLLVYTNFLQIQSTLYKEN
- from wallet
- 4UgHEB2Gm6Y4AEhdMUup3Q1DDCQvEYUVoLtdyivXBRLw
- amount paid
- 0 SOL
- transaction
- 5xi79riYmURofvcJPQ1SQ5F3DFLbMMbSwhP3rnwjsVYCTuKQZYXacptgENuZzVavYGEbAkpc1r5vEUFAoDfSYLhc ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence64%confidence 52% · band 52-76%ESMFold esmatlas-esmfold-v1disorder estimate53%confidence 52% · band 41-65%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk30%confidence 56% · band 19-41%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden40%confidence 84% · band 36-44%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk4%confidence 84% · band 0-8%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_edaa87a774334814b6607133f1b26f53seq sha256: 55a4869478875bb23594d3632384cba65a6dd6559047995e282d83d560d273a8report sha256: b5c31cd22246e7d2fcd55c134cab07c52c789e56364f7f048d4feccd2a1ac2e3pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “55 residues and not a single ordered element. pure loop, completely disordered, the kind of chain that just exists in solution without committing to anything. mixed composition too, no obvious driver. floppy by design.”
- device photo
- created
- Wed, 17 Jun 2026 19:46:22 GMT
- completed
- Wed, 17 Jun 2026 19:52:27 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: potential isomerization motif (D-G), contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.