specimen
#0357
status: complete
- sequence
- SLILGLLAYLVLVIQVTGIANNLEAALQTASFVPQTPRGYKVTAT
- from wallet
- 5DxbY9hNoqrDgZLpCLkmyrJyRK9GtpGXVgUBv8hnQnx7
- amount paid
- 0 SOL
- transaction
- tTGDbbyHzNAbEzaBHgZU3M4R7H6Ab4ahQ4k4AJfjCtC8u1AWVefqfCWVA6PajVBHbAtxQsUmTHvBYrR2nw1m6zA ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence76%confidence 52% · band 64-88%ESMFold esmatlas-esmfold-v1disorder estimate38%confidence 52% · band 26-50%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk36%confidence 56% · band 25-47%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden56%confidence 84% · band 52-60%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk2%confidence 84% · band 0-6%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk33%confidence 56% · band 22-44%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_9a8d486a736c4c67bb35060b3644f221seq sha256: aa6b2a0ba65d0c85213eb215d45a2f059f1cfc55048a67fbfbcb6b0b978093a0report sha256: 3cbf049b56c578a3aa059924daa144e5b780157a2c78d26af63df46941a577aepepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “45 residues and not a single ordered fragment. weirdly hydrophobic up front, leucines and valines stacked like it wants to be a membrane helix, but the fold says pure loop. something is repressed here.”
- device photo

- created
- Wed, 17 Jun 2026 19:45:48 GMT
- completed
- Wed, 17 Jun 2026 19:50:58 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence - 2. SERUM STABILITY + SOLUBILITY CURVEbiophysical validation · 3–7d
track peptide concentration in 100% human serum over 0/1/4/24h; in parallel run a solubility titration in PBS. tells you whether the peptide survives long enough to act.
trigger: hydrophobic_burden 56% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.