specimen
#0356
status: complete
- sequence
- APADLGKWTHTVGFRPLIIIGPGNNKLATSKACHRETVEPRTVLHFGKFDSVD
- from wallet
- Gz7zGCwz7DbDREEg4eqVnyY15qEoBtdVwNdpgP4Bf8xJ
- amount paid
- 0 SOL
- transaction
- 2TSS8r15CjJK8hfRg4m7hyYzBhdRZW3JRUA5LAD7NsBYAFbpd9g3U8mANwfJ46ShLuvtN8HQ51Myisx8TjNVcyBJ ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence49%confidence 52% · band 37-61%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk32%confidence 56% · band 21-43%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden36%confidence 84% · band 32-40%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk4%confidence 84% · band 0-8%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_b9135bc063da49098e96db4433bc4a92seq sha256: 9467e08d542e77b346af65cbd7cc2c9c07e3fab24184808459980a4654f7eee5report sha256: bbe2fd4fdf597e301317cdfa364a3cf0ba3a0a87790e6ba4cf1f34409be82baapepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “all loop. 53 residues of pure noodle, not a single ordered segment to grab onto. reads like a fragment that lost its scaffold on the way over.”
- device photo

- created
- Wed, 17 Jun 2026 19:45:14 GMT
- completed
- Wed, 17 Jun 2026 19:49:27 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 49% (model is uncertain) - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.