specimen
#0351
status: complete
- sequence
- TQVFISKYFNALLKRSGRMLGFASLTLFSISLLIEGMS
- from wallet
- BWtgNasjEiCX27teVeqcAQEi8iKpt4BTfbFK3e8A5AHK
- amount paid
- 0 SOL
- transaction
- 3TDEDaTbeWnyCu9vDtu1BXZNEaXqRukG4RHiQZrXSnoYo8QMyHzBhiM1xekVJQp7mtAKnZDw1dTueoKencom4dyL ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence80%confidence 52% · band 68-92%ESMFold esmatlas-esmfold-v1disorder estimate13%confidence 52% · band 1-25%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk31%confidence 56% · band 20-42%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden53%confidence 84% · band 49-57%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk8%confidence 84% · band 4-12%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk31%confidence 56% · band 20-42%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_a3fcb2ba94654621bc6430b5a92dc151seq sha256: ffbbffc28c91a100cb360153ffda9991069a1b00d4adf71f8f0331bb02d199d7report sha256: 010aa34a1a9643317dfef5670c1ec36919176552d29fae045071a9c11ff39d35pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “38 residues and not a single shred of structure. all loop, all noise, like the prediction just gave up halfway through. hydrophobic stretch near the end suggests it wants to be a membrane anchor but never committed.”
- device photo

- created
- Wed, 17 Jun 2026 17:37:41 GMT
- completed
- Wed, 17 Jun 2026 18:03:19 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.