#0348
- sequence
- HGDQKAIEDLRKATETILGPVAGAKVEHGTYAEAEDCERENFCGELAMAPSHKGLMLLAD
- from wallet
- DGPhtTEZfV3p8EhKe38AfoznKrac5q56LmYp2oEU1qMx
- amount paid
- 0 SOL
- transaction
- bGcBLMdQxvfdr8cDv2QjUconn4gfHV2qyQ6nErr4P7iN1uokpmKarb51YetSw54qHo3BsNVhkdhy1ZAPGE2RTje ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence53%confidence 52% · band 41-65%ESMFold esmatlas-esmfold-v1disorder estimate80%confidence 52% · band 68-92%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk31%confidence 56% · band 20-42%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden38%confidence 84% · band 34-42%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk10%confidence 84% · band 6-14%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk28%confidence 56% · band 17-39%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_0870b3aeb7cf44a88132e2efe3977782seq sha256: a76d53301f2e6f3f8341aed91b983896d03cf5aaa5e4ee0afcb75ae4e4629c91report sha256: 9e8580e211d75c76f7affefc4a274a97c02093985c04ee07ad20aa77dcbbd99fpepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “60 residues of pure loop. no helix, no sheet, just sixty amino acids holding hands and going nowhere in particular. mixed composition, charged and hydrophobic in equal measure, but nothing wants to commit to a structure.”
- device photo

- created
- Wed, 17 Jun 2026 17:35:55 GMT
- completed
- Wed, 17 Jun 2026 17:58:45 GMT
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible, multiple cysteines; disulfide heterogeneity risk, long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 3 motif liability flag(s) in the sequence - 2. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 53% (model is uncertain) - 3. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 80% (high)