specimen
#0333
status: complete
- sequence
- GKDFGCRKNGTFYLWSAQLDSLIHSNAGKTRPREIKEQARNKA
- from wallet
- 42hiyKWFgWHLgUygEcby82KKfvmRhmieAgmEjicNPpDZ
- amount paid
- 0 SOL
- transaction
- 4TYBUtv4TTiqAaJXpChh7wfkxuzVuiTGm6t1RUURgN36KtTKBPS6gVcTSNWfrgady3EF5G4zj27AcQG5CcStchuK ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence58%confidence 52% · band 46-70%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk31%confidence 56% · band 20-42%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden30%confidence 84% · band 26-34%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk12%confidence 84% · band 8-16%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- audit trail
- run: run_fd181599a1fd48cca3e330f041157f7fseq sha256: f7256143750c67dfce5ac5aea2ce32153fdf448e22648dd4d1c807ca6d4c02ffreport sha256: 2be972682ed540e1aa51898fa75d96ab7513221097aafd9395b5d6aeb620ec5bpepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “all loop, no structure. 43 residues of pure indecision, like it forgot to commit to anything. lots of charged residues scattered through it, probably happiest dissolved in water and going nowhere.”
- device photo
- created
- Wed, 17 Jun 2026 17:26:42 GMT
- completed
- Wed, 17 Jun 2026 17:36:39 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: potential deamidation motif (N-G). minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence - 2. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 58% (model is uncertain) - 3. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.