specimen
#0033
status: complete
- sequence
- CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
- from wallet
- 92g1DJoHqrzNriKDM6RLyYDgNyCehujStfVpAvvSeQwF
- amount paid
- 0 SOL
- transaction
- 5gFQfCfz3Ysy2DddNhFQaT4A3YUEY7VPNnmL7swtasBX7VzYprjBzDbfCy2xBxmyS7FCMno6xo3R8Lhk75Zr4xty ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence51%confidence 52% · band 39-63%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk32%confidence 56% · band 21-43%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden34%confidence 84% · band 30-38%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk0%confidence 84% · band 0-4%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk26%confidence 56% · band 15-37%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- audit trail
- run: run_55c2b20c5bbc4a548aedd4fe1f8c14f7seq sha256: 8f73419ca44fa99b01a938bc6a286368161342df229120da1213eaa3616c5236report sha256: ad892faaf1a7bd890ffba6105383f1595d3d979f16f63d3b5a46ce0bef589e54pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “all loop, no structure. 32 residues of pure flop, not a single helix or strand to anchor it. looks like a fragment ripped out of context, doing nothing on its own.”
- device photo
- created
- Tue, 16 Jun 2026 04:02:14 GMT
- completed
- Tue, 16 Jun 2026 04:13:33 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible, multiple cysteines; disulfide heterogeneity risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence - 2. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 51% (model is uncertain) - 3. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.