specimen
#0325
status: complete
- sequence
- FLPWPSGSLVIDWISALALHATTDLRTKFFLYSDRHYYW
- from wallet
- 62ef4jLfuT2zYFwBsTqHCHXMWkHAPiNn7dfeEn8qj37Q
- amount paid
- 0 SOL
- transaction
- 58vyvxx3wkJq9N6hEWCo5EQoqrnRFFR9WZ4eAwrmkAY6399W26snPtrSvCwwG8P9zHdhkmeKUFr3BMaHrkAKqt2e ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence52%confidence 52% · band 40-64%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk44%confidence 56% · band 33-55%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden54%confidence 84% · band 50-58%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk0%confidence 84% · band 0-4%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk37%confidence 56% · band 26-48%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- audit trail
- run: run_70450185c4ef405096345da3bf0c2e09seq sha256: 57cfc9a449648719c93e60149fabefb0ddd6e10ba4f790a1f668eb023015b115report sha256: 6c31fb7cb61e9d6709bad5d966ffe61f7bea0ae1419335714575185d69fe4e54pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “39 residues and not a single ordered fragment. all loop, completely floppy, like it gave up halfway through deciding what to be. composition is busy though, aromatics and charges scattered around with no apparent plan.”
- device photo
- created
- Wed, 17 Jun 2026 17:21:58 GMT
- completed
- Wed, 17 Jun 2026 17:25:06 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 52% (model is uncertain) - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.