specimen
#0324
status: complete
- sequence
- NAYSKAVGPLAHAVALSILTCKDYITNYVYAGMYVCIFTFLKFVVRHLLNK
- from wallet
- 5Dy8AaYHrAHDwPHXcKMZNSv7C1SUc9EJpqwRnURdx6oQ
- amount paid
- 0 SOL
- transaction
- 3fNQdp3UKcpVrNnFntxVPbtJTQfsWsaqRKCWqKnm496e8cdXZELSn5Rs9Rad5iBKXZDQSePjwLaFHa47KrE9ECop ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence68%confidence 52% · band 56-80%ESMFold esmatlas-esmfold-v1disorder estimate63%confidence 52% · band 51-75%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk41%confidence 56% · band 30-52%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden59%confidence 84% · band 55-63%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk8%confidence 84% · band 4-12%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk38%confidence 56% · band 27-49%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: predicted disorder is elevated
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_508471b2bb074591af9f16f5c61ad7e8seq sha256: 54c5b14ddca25319b52d31f3c482128282288975b37921bf46c0dc29535ea15creport sha256: 1b236d5bf9676b6126a9e182d7c10306ffcbec02e8144c77c2c09854abbc6839pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “51 residues and not a single secondary structure element. all loop, completely unstructured, which is suspicious given how hydrophobic the middle gets. should be burying itself somewhere but instead it just flops. weird one.”
- device photo

- created
- Wed, 17 Jun 2026 17:21:22 GMT
- completed
- Wed, 17 Jun 2026 17:23:39 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible, multiple cysteines; disulfide heterogeneity risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 63% (high) - 3. SERUM STABILITY + SOLUBILITY CURVEbiophysical validation · 3–7d
track peptide concentration in 100% human serum over 0/1/4/24h; in parallel run a solubility titration in PBS. tells you whether the peptide survives long enough to act.
trigger: hydrophobic_burden 59% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.