specimen
#0315
status: complete
- sequence
- ITLFLAIANIHSDQNSVHFMPHYYRPGLAIEQREL
- from wallet
- 5yNjktkbVSBbNFS7tCzzDPBbWnEyJbnmbxfapxfj2RsY
- amount paid
- 0 SOL
- transaction
- 34FP518GtghxV9B9yfdiykMLaABG4zKFMuh7qDsVu2MNZPbjTQVihoRXhUD14PX8oGrPE2FMDwYwJj5jEm6JPGfp ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence55%confidence 52% · band 43-67%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk40%confidence 56% · band 29-51%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden49%confidence 84% · band 45-53%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk3%confidence 84% · band 0-7%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk35%confidence 56% · band 24-46%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- audit trail
- run: run_4a49e0ee09be4d6d9350d9b550cb1686seq sha256: 9e8370d8b0d8e042c30d5796435719ea1b724f5c7c6f49d5a9855652894b4577report sha256: 88b41aa057e5216790dad1f8f3d852655a04b3572eaa72add5d53a6d866b7cbepepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “100% loop. 35 residues of pure indecision, no helix, no sheet, nothing committing to anything. hydrophobics scattered across the chain with no core to bury them in. structurally homeless.”
- device photo
- created
- Wed, 17 Jun 2026 16:23:43 GMT
- completed
- Wed, 17 Jun 2026 16:43:59 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible, long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence - 2. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 55% (model is uncertain) - 3. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.