specimen
#0312
status: complete
- sequence
- RVQESNLRTESGTLIYVEIVSRGVYDNQLEEKDVTALSVTGVDNHGKTPNE
- from wallet
- 7MwD77ZYhYzKLZ2cC3AKjEzCVFkHzbGuCzR4PsNAU3AV
- amount paid
- 0 SOL
- transaction
- 5vhWTxdamWBo74EsZKzvWS4oiyC1FYvq2LAXos1hXayX9L4eqxNmS1SUZPyXY9uA7hYB7vdBML7SNfmjT3kJ7xbw ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence48%confidence 52% · band 36-60%ESMFold esmatlas-esmfold-v1disorder estimate100%confidence 52% · band 88-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk30%confidence 56% · band 19-41%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden31%confidence 84% · band 27-35%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk8%confidence 84% · band 4-12%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk26%confidence 56% · band 15-37%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- synthesis hints
- - sequence length >45 aa may reduce synthesis yield
- audit trail
- run: run_5e35499e0cd84f2eb972d5c200e9bb84seq sha256: 41030b8bc48986bbc25ca59c4c7053be2f3f24505ea7ab89b2e0ad2e69883b87report sha256: 925413f63ca793cd6ac6aac393c5724d49361b2f8d2b879c44c711bf187f8026pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “100% loop. no helix, no sheet, just 51 residues of pure indecision. reads like a fragment that fell off something larger and forgot how to fold on its own.”
- device photo

- created
- Wed, 17 Jun 2026 16:21:58 GMT
- completed
- Wed, 17 Jun 2026 16:39:19 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 48% (model is uncertain) - 2. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.