pepscanPepScan
specimen

#0307

status: complete
download JSONdownload PDFchat with report
sequence
VETYDVVAHLAFSGNSEAWKDLNWQYIAADNVQQAEGEVKIVIDEKDADDQEV
amount paid
0 SOL
structure
0% helix · 0% sheet · 100% loop
actionable triage
fold confidence44%
confidence 52% · band 32-56%
ESMFold esmatlas-esmfold-v1
disorder estimate100%
confidence 52% · band 88-100%
PEPFOLD structure heuristic pepfold-triage-v1
aggregation risk39%
confidence 56% · band 28-50%
PEPFOLD developability heuristic pepfold-triage-v1
hydrophobic burden45%
confidence 84% · band 41-49%
PEPFOLD sequence analyzer pepfold-triage-v1
charge distribution risk19%
confidence 84% · band 15-23%
PEPFOLD sequence analyzer pepfold-triage-v1
solubility risk36%
confidence 56% · band 25-47%
PEPFOLD developability heuristic pepfold-triage-v1
developability flags
medium: structure confidence is limited
medium: predicted disorder is elevated
synthesis hints
  • - sequence length >45 aa may reduce synthesis yield
audit trail
run: run_d1edf75c279149a288f4617684d2e33e
seq sha256: 11bb3cde4220db411e07189a6241797ef3c0a80cae342fe3c7e3c2bb79372827
report sha256: 0aaf53dbe2a9ed9130c7b9dd1a989bf7e280828f814a3eede84771ff69b18fea
pepfold-triage-v1 · esmatlas-esmfold-v1
pep
“53 residues of pure loop. no helix, no sheet, just a long floppy ribbon with nowhere to go. lots of charged residues near the tail, like it's trying to stay soluble while having no opinions about shape.”
device photo
device photo for specimen #307
created
Wed, 17 Jun 2026 16:19:00 GMT
completed
Wed, 17 Jun 2026 16:32:07 GMT
next experiment

what to do next

deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.

  1. 1. CD SPECTROSCOPY
    biophysical validation · 1–3d

    experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.

    trigger: fold_confidence 44% (model is uncertain)
  2. 2. 1H-15N HSQC
    biophysical validation · 2–5d

    if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.

    trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.