specimen

#0304

status: complete
download JSONdownload PDFchat with report
sequence
QVVKITTPVGIAVLFETVQELADAVALEVQGMCSMLKYPQQLSGNEPFFRKCM
amount paid
0 SOL
structure
0% helix · 0% sheet · 100% loop
actionable triage
fold confidence63%
confidence 52% · band 51-75%
ESMFold esmatlas-esmfold-v1
disorder estimate60%
confidence 52% · band 48-72%
PEPFOLD structure heuristic pepfold-triage-v1
aggregation risk33%
confidence 56% · band 22-44%
PEPFOLD developability heuristic pepfold-triage-v1
hydrophobic burden47%
confidence 84% · band 43-51%
PEPFOLD sequence analyzer pepfold-triage-v1
charge distribution risk2%
confidence 84% · band 0-6%
PEPFOLD sequence analyzer pepfold-triage-v1
solubility risk30%
confidence 56% · band 19-41%
PEPFOLD developability heuristic pepfold-triage-v1
developability flags
medium: predicted disorder is elevated
synthesis hints
  • - sequence length >45 aa may reduce synthesis yield
audit trail
run: run_255c9c0ac5164d17921b013a59841ef0
seq sha256: 71406ad2e70cab6b4ad053f514cb7ba6aa3cc7db1944156bfe333aeef12873d5
report sha256: 9a9df251d77f75c5cf5547e8b3136d24cff924a6b452168fa6b76c3de74f17ed
pepfold-triage-v1 · esmatlas-esmfold-v1
pep
53 residues and not a single ordered segment. all loop, completely floppy, like the fold gave up before it started. interesting amino acid mix though, plenty of hydrophobics that should be doing something but aren't.
device photo
device photo for specimen #304
created
Wed, 17 Jun 2026 16:17:11 GMT
completed
Wed, 17 Jun 2026 16:27:36 GMT
next experiment

what to do next

deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.

  1. 1. LIABILITY REDESIGN ROUND
    in silico only · 0–1d

    redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible, multiple cysteines; disulfide heterogeneity risk, long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).

    trigger: 3 motif liability flag(s) in the sequence
  2. 2. 1H-15N HSQC
    biophysical validation · 2–5d

    if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.

    trigger: disorder_estimate 60% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.