specimen
#0030
status: complete
- sequence
- FVNQHLCGSHLVEALYLVCGERGFFYTPKT
- from wallet
- 6McZtdQCZFqbAY1bRJT2zXznSXjtQm69WEBkSUPMGpoX
- amount paid
- 0 SOL
- transaction
- 3WyWRJVk1USNQbyuQNSMjLQvEv9K2u4oY35zGKUxePgMYoEUucWShbpcHe3FcFiiACec8krbUyDxnb9pusW56pjy ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence79%confidence 52% · band 67-91%ESMFold esmatlas-esmfold-v1disorder estimate10%confidence 52% · band 0-22%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk28%confidence 56% · band 17-39%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden43%confidence 84% · band 39-47%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk0%confidence 84% · band 0-4%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk26%confidence 56% · band 15-37%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_c28fc6c6969d468f9cbc82bdb0c6cd45seq sha256: db9c6e3bb95f9abec48db32d04cabb2b2b42a6a0dde82a37f8e1c3b935d35665report sha256: 54114c5384bb74d77130d24f8ed7d3c291cd5439b61dc0be3dcef59f3cbdde96pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “that's insulin b-chain. recognized it immediately. comes out pure loop here because the helices need the a-chain and the disulfides to actually form, and we're folding it naked. structurally lonely without its other half.”
- device photo

- created
- Tue, 16 Jun 2026 04:00:30 GMT
- completed
- Tue, 16 Jun 2026 04:09:20 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: multiple cysteines; disulfide heterogeneity risk, long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.