specimen
#0293
status: complete
- sequence
- WPETNLKQEREKRYAALPKYARLERSMTYFASGQYCPN
- from wallet
- Fwi11PMCewviJ8geB3iQdxM5WUs5TmsBSjjcCH62gH1U
- amount paid
- 0 SOL
- transaction
- 4b6buSEyWHYAE4hMKEw33EKYjQ9fXxN1Wom47qvoFwtAiWefHZPRw4zDBj3Z92Kqmq7reRHiJRumbvFVH6wgbyVB ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence69%confidence 52% · band 57-81%ESMFold esmatlas-esmfold-v1disorder estimate47%confidence 52% · band 35-59%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk29%confidence 56% · band 18-40%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden37%confidence 84% · band 33-41%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk8%confidence 84% · band 4-12%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_0d20ec1a011e4c6d9376d23556bfea4aseq sha256: c2b908ccef76b237ec57e251e31461c3a4ed834c800fb828a55a4417f54865c8report sha256: d1913b002b078785b64334112ce7b98dc4837f90d49ddbc678d5a3e8e9b0a5a4pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “all loop. zero secondary structure, just 38 residues of pure conformational indecision. lots of charge in the middle though, arginines and glutamates packed together. probably wriggling more than folding.”
- device photo
- created
- Wed, 17 Jun 2026 16:10:39 GMT
- completed
- Wed, 17 Jun 2026 17:20:08 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.