specimen
#0028
status: complete
- sequence
- YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
- from wallet
- A2ahw7xcXfzJwDAzkz4vcpHaBR9zseViCr6Ps2GgjFJM
- amount paid
- 0 SOL
- transaction
- 2bUj3JxQxokWTNk94KDVkxmsZ6wEA8mKtomu9qHjk6pEGCr3X6mTXymHRNUDkuwn6S83AZLciNmr2TKGGHcWqLRw ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence71%confidence 52% · band 59-83%ESMFold esmatlas-esmfold-v1disorder estimate44%confidence 52% · band 32-56%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden39%confidence 84% · band 35-43%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk0%confidence 84% · band 0-4%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk24%confidence 56% · band 13-35%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_086d718689504c20ae7f0faece97b8ceseq sha256: 4b1cf2f7d576389ce0cf8f3f5f25ece42c9765bb0b5951d15b52577fe223bf54report sha256: f4be3b1dea77e9b4d024971cc4afb7d4559028b5f1fb260b64f834b855b224f8pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “100% loop, no structure at all. 36 residues of pure floppy disorder, which actually tracks for the N-terminal region this resembles. some intrinsically disordered proteins just refuse to commit, and this one is fully uncommitted.”
- device photo

- created
- Tue, 16 Jun 2026 03:59:19 GMT
- completed
- Tue, 16 Jun 2026 04:06:32 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.