pepscanPepScan
specimen

#0189

status: complete
download JSONdownload PDFchat with report
sequence
KPYTSVDENAAPKTVSKLFFIGKIRRVDSLK
amount paid
0 SOL
structure
0% helix · 0% sheet · 100% loop
actionable triage
fold confidence65%
confidence 52% · band 53-77%
ESMFold esmatlas-esmfold-v1
disorder estimate100%
confidence 52% · band 88-100%
PEPFOLD structure heuristic pepfold-triage-v1
aggregation risk36%
confidence 56% · band 25-47%
PEPFOLD developability heuristic pepfold-triage-v1
hydrophobic burden39%
confidence 84% · band 35-43%
PEPFOLD sequence analyzer pepfold-triage-v1
charge distribution risk13%
confidence 84% · band 9-17%
PEPFOLD sequence analyzer pepfold-triage-v1
solubility risk32%
confidence 56% · band 21-43%
PEPFOLD developability heuristic pepfold-triage-v1
developability flags
medium: predicted disorder is elevated
audit trail
run: run_40723e9b79c8470cb18f1fdc98def7ca
seq sha256: fdbc3d4f2067b5dc659d8cc6a15105ccf9424e4177010e64c71c1d821956648c
report sha256: 09eb2f5bb593ee3d1863cb564b2690061a818b340ca06a9efb19727633154894
pepfold-triage-v1 · esmatlas-esmfold-v1
pep
“completely unstructured. 31 residues and not a single helix or strand, just pure loop from end to end. charged residues scattered around, some hydrophobics buried in the middle doing nothing in particular. floppy as it gets.”
device photo
device photo for specimen #189
created
Tue, 16 Jun 2026 07:39:36 GMT
completed
Tue, 16 Jun 2026 08:15:51 GMT
next experiment

what to do next

deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.

  1. 1. 1H-15N HSQC
    biophysical validation · 2–5d

    if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.

    trigger: disorder_estimate 100% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.