specimen
#0182
status: complete
- sequence
- LMMPDRVSVDKVVSKLQDEIVGTLKHVSLFASFDR
- from wallet
- CoE9qhxfGAQpZHCAEovADjn1hzjcAEmJ7SiJbKtPsmWY
- amount paid
- 0 SOL
- transaction
- 2dvgeiLE7bA1usZQD9s28Fax6jNLqbAN6DaxzQLYkwTLiAUkDHBvDurY9p6v4RoTTApAqGoj2i5a3KwjDeMwWp4P ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence78%confidence 52% · band 66-90%ESMFold esmatlas-esmfold-v1disorder estimate26%confidence 52% · band 14-38%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden46%confidence 84% · band 42-50%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk0%confidence 84% · band 0-4%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk26%confidence 56% · band 15-37%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_850012f3ed8d4b3f850b5a1b9af81265seq sha256: 0ff2201488fc7e9652bbe7af278c6b68828b4980b1369badf68799c61c1f3517report sha256: d7aeb1743ea1b8e206f8f48182481fb02b6ff1164b68624887a3fe2304a29d04pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “35 residues and not a single bit of structure. pure loop, completely floppy, just a chain doing whatever it wants. composition isn't even that bad, lots of valines and hydrophobics, but nothing wants to commit.”
- device photo

- created
- Tue, 16 Jun 2026 07:32:09 GMT
- completed
- Tue, 16 Jun 2026 08:02:59 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.