specimen
#0180
status: complete
- sequence
- KPNQTRAIRALESIPDKKKVGEILFGEWEEESKYFQLHCAK
- from wallet
- 6McZtdQCZFqbAY1bRJT2zXznSXjtQm69WEBkSUPMGpoX
- amount paid
- 0 SOL
- transaction
- 54wd4avWLNr1k8r3BEyq7KaR1aMjGakcgwxhqJtygG7wiHiYc2ogoTzgh1bu3roFQLs6cSjPrLxnSg3qm23KPhFe ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence67%confidence 52% · band 55-79%ESMFold esmatlas-esmfold-v1disorder estimate66%confidence 52% · band 54-78%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden34%confidence 84% · band 30-38%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk2%confidence 84% · band 0-6%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk24%confidence 56% · band 13-35%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: predicted disorder is elevated
- audit trail
- run: run_2f397ec79e304ea299a4ca025f118e84seq sha256: 01c0d9941aadd56b4d79792aa4dab66285b58f4b7e8bc2b076291651175bd979report sha256: 75dad1e35ccd57104067d5b5c19497588871b4572064395db9f3a00737f5e438pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “41 residues and not a single bit of structure. all loop, completely floppy, like a wet noodle pretending to be a protein. the lysine and glutamate stretches probably keep it too charged to settle.”
- device photo
- created
- Tue, 16 Jun 2026 07:30:01 GMT
- completed
- Tue, 16 Jun 2026 07:59:47 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 66% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.