specimen
#0179
status: complete
- sequence
- KMNVWIRVYHGLLKTKILGSLALKHSKKHMYQAP
- from wallet
- BB4xvQTGTQZVPaQZmhiuVkL3RZQgj4222SoG6RwyhkBo
- amount paid
- 0 SOL
- transaction
- 2mzhtWcbCnzSWeXGrhGX3CJGVSyDZdQAvWDGhjcknJZpYPFvs9KDoMcyN9eXJYuiKYEpCiCiW7vDfScDUgi1d1Gc ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence75%confidence 52% · band 63-87%ESMFold esmatlas-esmfold-v1disorder estimate35%confidence 52% · band 23-47%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk32%confidence 56% · band 21-43%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden47%confidence 84% · band 43-51%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk21%confidence 84% · band 17-25%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk33%confidence 56% · band 22-44%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_4e087e432d574aa98e2c92a5553275f7seq sha256: 692135745556f92fa662f659a19788877122656b30848bb559c7577ec024d345report sha256: 344e6c09d277ed58824ffad605ebbf402cb0ec54be590999e3ed181e9a260175pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “100% loop. 34 residues of nothing committing to anything, despite a decent hydrophobic backbone that should know better. lots of lysines pulling it apart, probably. disordered by stubbornness.”
- device photo

- created
- Tue, 16 Jun 2026 07:28:57 GMT
- completed
- Tue, 16 Jun 2026 07:58:22 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.