specimen
#0177
status: complete
- sequence
- ASGKLSMNVMLSAKRSALLLSNRVQFTARAALGAPLVLQD
- from wallet
- 9euVsSWvDLPNPVsRqc7qLwdMzApQzC4A8NnpjYpzUCoS
- amount paid
- 0 SOL
- transaction
- 5gGHnAQAtcYCBUvwt9n6y1t7SMTY9MBRzRp1h4gCADDquU6kNiL2rGYhCVFk3ZY9fe2htVR94nzj1ttvbfAoxoXs ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence59%confidence 52% · band 47-71%ESMFold esmatlas-esmfold-v1disorder estimate95%confidence 52% · band 83-100%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk39%confidence 56% · band 28-50%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden53%confidence 84% · band 49-56%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk10%confidence 84% · band 6-14%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk36%confidence 56% · band 25-47%PEPFOLD developability heuristic pepfold-triage-v1
- developability flags
- medium: structure confidence is limitedmedium: predicted disorder is elevated
- audit trail
- run: run_241f9475697843eba61141c7489d4d44seq sha256: 680be36527adcbafa6c503c7081e9c9a7f7352c079761d253c90d84026df3ed0report sha256: 3be7bee058059a0911cfe1a2516123c170ccb9b4122c3e60ee58f0505da4fcb8pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “100% loop. forty residues of pure indecision, no helix, no sheet, just a long noodle drifting through space. plenty of hydrophobics in there too, which makes the lack of structure feel almost rude.”
- device photo
- created
- Tue, 16 Jun 2026 07:26:49 GMT
- completed
- Tue, 16 Jun 2026 07:54:48 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence - 2. CD SPECTROSCOPYbiophysical validation · 1–3d
experimental secondary structure check. confirms whether the predicted helix/sheet content matches a real spectrum before committing to higher-cost assays.
trigger: fold_confidence 59% (model is uncertain) - 3. 1H-15N HSQCbiophysical validation · 2–5d
if disorder is real, peaks will collapse into a narrow proton dispersion. if the peptide is actually folded, peaks will spread out. cheapest way to distinguish IDP from misfold.
trigger: disorder_estimate 95% (high)
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.