specimen
#0165
status: complete
- sequence
- LARATMNDLWTAFLKNPDSLEPSDFSVKSIGEARSSLQRGGKLR
- from wallet
- 4QrqjQgWDiX4hAGYX3RuCTLnijoDJgkpCmZrb9bX9zxL
- amount paid
- 0 SOL
- transaction
- 472NB6f1gtjjYx57WCNYgzWZWZECF8b4gjynRuEDgSGP9rgH3mU9XafCbi1XJToTQbL4i4M9sbmidCB9VaLazbKE ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence71%confidence 52% · band 59-83%ESMFold esmatlas-esmfold-v1disorder estimate34%confidence 52% · band 22-46%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk24%confidence 56% · band 13-35%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden36%confidence 84% · band 32-40%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk5%confidence 84% · band 1-9%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk23%confidence 56% · band 12-34%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_dda30c598707452e8f82af04982a47f3seq sha256: ce276bafbff771f73fc36cf53dd7cd34b344236dcab15e5c6d51645218048877report sha256: 7c038f2a76a2e2e4a1fe26d274569399af020d77bf64b9bc94c003c9f348d359pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “44 residues of pure loop. no helix, no sheet, just a long floppy string drifting through space. composition is all over the place too, charged residues scattered like it can't commit to a personality.”
- device photo

- created
- Tue, 16 Jun 2026 07:13:59 GMT
- completed
- Tue, 16 Jun 2026 07:36:10 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.