specimen
#0144
status: complete
- sequence
- AQFECEKRGQVIELRHMLLMLAESRDAYLSARAALD
- from wallet
- 5zpeT5UkFutgw4FkdHvKu9EsnzrNHxWFPdQJ5mYxP52X
- amount paid
- 0 SOL
- transaction
- 65riQSZqjNzVDmfqetCndJ8ejBHJ7d9HgLiqhpFwkiS8VvepfFQjiYZzz27TmsZWJ1tUrYym2ZPiXPx5m65P7bYj ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence88%confidence 52% · band 76-100%ESMFold esmatlas-esmfold-v1disorder estimate3%confidence 52% · band 0-15%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk28%confidence 56% · band 17-39%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden50%confidence 84% · band 46-54%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk3%confidence 84% · band 0-7%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk28%confidence 56% · band 17-39%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_b74953e9c7714952a035f3814b7d5179seq sha256: b0d7a0796263cd1c712d50d5bb288919c2a33b20422724cad6a71e3caa148c26report sha256: 71dc70e49aa9c8f266215bb588e4e2c153f0173e4760f251d3e9fc10c71da182pepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “36 residues and not a single hint of structure. pure loop, completely undecided, just a long floppy string of charges and hydrophobics that never commits to anything. disappointing in an interesting way.”
- device photo

- created
- Tue, 16 Jun 2026 06:51:32 GMT
- completed
- Tue, 16 Jun 2026 07:02:39 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: contains methionine; oxidation sensitivity possible, long hydrophobic run may increase aggregation risk. minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 2 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.